PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN40355.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 261aa    MW: 29276.9 Da    PI: 6.2418
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN40355.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.3e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed  l+++ +++G+g +W + +++ g++R++k+c++rw++yl
       KHN40355.1 14 RGPWSPDEDATLKNYLEKHGTGgNWIALPKKAGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding43.85.8e-1471112446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +T+eEd ++  +    G+++W++Ia+ ++ gRt++++k++w++
       KHN40355.1  71 FTEEEDNIICTLYDIIGSRQWSLIAAQLP-GRTDNDVKNHWNT 112
                      9****************************.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.719962IPR017930Myb domain
SuperFamilySSF466892.07E-2611110IPR009057Homeodomain-like
SMARTSM007171.1E-111364IPR001005SANT/Myb domain
PfamPF002494.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-231569IPR009057Homeodomain-like
CDDcd001675.57E-91662No hitNo description
PROSITE profilePS5129420.68863118IPR017930Myb domain
SMARTSM007172.5E-1167116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2170117IPR009057Homeodomain-like
PfamPF002493.0E-1270112IPR001005SANT/Myb domain
CDDcd001675.03E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MGRAPCCDKS NVKRGPWSPD EDATLKNYLE KHGTGGNWIA LPKKAGLKRC GKSCRLRWLN  60
YLRPHIKLGG FTEEEDNIIC TLYDIIGSRQ WSLIAAQLPG RTDNDVKNHW NTKLKKKFLA  120
GNTSSSIATT SNNIVTFSNT SYSHQVEGLV LDQKLNPANW FDSYDVNFEL EQTPIPVPFP  180
MPQELEAFNY TGSISCSTAP PPYKEVSLML SNADKHTLWF GYDQASEDDP NLLEFVLDDL  240
HQMNQGFVFQ DKSSQVGPPS G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-24141187108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9028630.0DQ902863.1 Glycine max transcription factor MYBJ6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583568.10.0PREDICTED: transcription factor RAX2-like
TrEMBLA0A0B2S5030.0A0A0B2S503_GLYSO; Transcription factor RAX3
STRINGGLYMA07G15250.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.11e-69myb domain protein 68
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]